TGDS Antibody - middle region : Biotin

TGDS Antibody - middle region : Biotin
SKU
AVIARP55009_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TGDS

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: dTDP-D-glucose 4,6-dehydratase

Protein Size: 350

Purification: Affinity Purified
More Information
SKU AVIARP55009_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55009_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23483
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×