THNSL2 Antibody - middle region : Biotin

THNSL2 Antibody - middle region : Biotin
SKU
AVIARP57188_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: THNSL2 acts as a catabolic phospho-lyase on both gamma- and beta-phosphorylated substrates.THNSL2 dDegrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THNSL2

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Threonine synthase-like 2

Protein Size: 484

Purification: Affinity Purified
More Information
SKU AVIARP57188_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57188_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55258
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×