TKTL1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Strong TKTL1 protein expression has been correlated with a certain type of glucose metabolism (aerobic glycolysis; Warburg effect) and to cells which are affected by chronic complications of diabetic patients. In colon and urothelial carcinomas, expression at the protein level is correlated with invasiveness of tumors and poor patient survival.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TKTL1

Key Reference: Langbein,S., (2008) Int. J. Cancer 122 (11), 2422-2428

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transketolase-like protein 1

Protein Size: 596

Purification: Affinity Purified

• SKU: AVIARP53676_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53676_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 8277
• Host: Rabbit
• Conjugate: Conjugated, Biotin