TKTL1 Antibody - middle region : FITC

TKTL1 Antibody - middle region : FITC
SKU
AVIARP53676_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Strong TKTL1 protein expression has been correlated with a certain type of glucose metabolism (aerobic glycolysis; Warburg effect) and to cells which are affected by chronic complications of diabetic patients. In colon and urothelial carcinomas, expression at the protein level is correlated with invasiveness of tumors and poor patient survival.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TKTL1

Key Reference: Langbein,S., (2008) Int. J. Cancer 122 (11), 2422-2428

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transketolase-like protein 1

Protein Size: 596

Purification: Affinity Purified
More Information
SKU AVIARP53676_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53676_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 8277
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×