TMED8 Antibody - middle region : Biotin

TMED8 Antibody - middle region : Biotin
SKU
AVIARP56017_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMED8

Key Reference: Petroziello,J., (2004) Oncogene 23 (46), 7734-7745

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein TMED8

Protein Size: 325

Purification: Affinity Purified
More Information
SKU AVIARP56017_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56017_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283578
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×