TMEM146 Antibody - middle region : HRP

TMEM146 Antibody - middle region : HRP
SKU
AVIARP55551_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TMEM146 is a single-pass type I membrane protein. The functions of TMEM146 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM146

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: NPHSLGFQATFYENGYTSDGNTKYKLDIFLKQQQHWGRTDSNFTSSLKKA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cation channel sperm-associated protein subunit delta

Protein Size: 798

Purification: Affinity Purified
More Information
SKU AVIARP55551_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55551_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 257062
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×