TMF1 Antibody - N-terminal region : Biotin

TMF1 Antibody - N-terminal region : Biotin
SKU
AVIARP58092_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMF1

Key Reference: Yamane,J., (2007) Exp. Cell Res. 313 (16), 3472-3485

Molecular Weight: 123kDa

Peptide Sequence: Synthetic peptide located within the following region: TPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TATA element modulatory factor

Protein Size: 1093

Purification: Affinity Purified
More Information
SKU AVIARP58092_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58092_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7110
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×