TMPRSS12 Antibody - middle region : Biotin

TMPRSS12 Antibody - middle region : Biotin
SKU
AVIARP55819_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMPRSS12

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: KEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDEDGAFDTC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transmembrane protease serine 12

Protein Size: 348

Purification: Affinity Purified
More Information
SKU AVIARP55819_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55819_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283471
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×