TOB2 Antibody - middle region : FITC

TOB2 Antibody - middle region : FITC
SKU
AVIARP58112_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TOB2 belongs to the TOB/BTG1 family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TOB2

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: EGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Tob2

Protein Size: 344

Purification: Affinity Purified
More Information
SKU AVIARP58112_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58112_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10766
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×