TPRKB Antibody - middle region : FITC

TPRKB Antibody - middle region : FITC
SKU
AVIARP56819_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TPRKB

Key Reference: Miyoshi,A., (2003) Biochem. Biophys. Res. Commun. 303 (2), 399-405

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TP53RK-binding protein

Protein Size: 175

Purification: Affinity Purified
More Information
SKU AVIARP56819_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56819_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51002
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×