Traf3ip1 Antibody - N-terminal region : FITC

Traf3ip1 Antibody - N-terminal region : FITC
SKU
AVIARP55316_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Traf3ip1 play an inhibitory role on IL13 signaling by binding to IL13RA1. It is involved in suppression of IL13-induced STAT6 phosphorylation, transcriptional activity and DNA-binding. It recruits TRAF3 and DISC1 to the microtubules.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Traf3ip1

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: VIRITGFMKGLYTDAEMKSENVKDKDAKISFLQKAIDVVMMVSGEPLAAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TRAF3-interacting protein 1

Protein Size: 625

Purification: Affinity Purified
More Information
SKU AVIARP55316_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55316_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 74019
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×