Transcobalamin 2 antibody

Calculated MW: 48

Form: Liquid

Buffer (with preservative): PBS, 2% Sucrose, 0.09% Sodium Azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Uniprot ID: O88968

Antigen Species: Mouse

Immunogen: A synthetic peptide corresponding to a region of Mouse: PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: transcobalamin 2

• SKU: GTX04825-100
• Manufacturer: GeneTex
• Manufacturer SKU: GTX04825-100
• Package Unit: 100 μl
• Quantity Unit: STK
• Reactivity: Mouse (Murine)
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 21452
• Host: Rabbit
• Conjugate: Unconjugated