TRAPPC1 Antibody - middle region : FITC

TRAPPC1 Antibody - middle region : FITC
SKU
AVIARP57531_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRAPPC1

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trafficking protein particle complex subunit 1

Protein Size: 145

Purification: Affinity Purified

Subunit: 1
More Information
SKU AVIARP57531_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57531_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 58485
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×