TRAPPC2L Antibody - N-terminal region : Biotin

TRAPPC2L Antibody - N-terminal region : Biotin
SKU
AVIARP56852_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRAPPC2L

Key Reference: Rual,J.F., (2005) Nature 437 (7062), 1173-1178

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trafficking protein particle complex subunit 2-like protein

Protein Size: 140

Purification: Affinity Purified

Subunit: 2-like protein
More Information
SKU AVIARP56852_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56852_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51693
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×