TRAPPC4 Antibody - middle region : FITC

TRAPPC4 Antibody - middle region : FITC
SKU
AVIARP56842_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRAPPC4

Key Reference: Gavin,A.C., (2002) Nature 415 (6868), 141-147

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trafficking protein particle complex subunit 4

Protein Size: 219

Purification: Affinity Purified

Subunit: 4
More Information
SKU AVIARP56842_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56842_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51399
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×