TRIB3 Antibody - N-terminal region : HRP

TRIB3 Antibody - N-terminal region : HRP
SKU
AVIARP57518_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIB3

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tribbles homolog 3

Protein Size: 358

Purification: Affinity Purified
More Information
SKU AVIARP57518_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57518_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57761
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×