TRIM10 Antibody - C-terminal region : Biotin

TRIM10 Antibody - C-terminal region : Biotin
SKU
AVIARP57848_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM10

Key Reference: Shiina,T., (2006) Genetics 173 (3), 1555-1570

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: LRPEEGVWAVRLAWGFVSALGSFPTRLTLKEQPRQVRVSLDYEVGWVTFT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tripartite motif-containing protein 10

Protein Size: 481

Purification: Affinity Purified
More Information
SKU AVIARP57848_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57848_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10107
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×