TRIM15 Antibody - middle region : Biotin

TRIM15 Antibody - middle region : Biotin
SKU
AVIARP58130_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TRIM15 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Its function has not been identified. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM15

Key Reference: Uchil,P.D., PLoS Pathog. 4 (2), E16 (2008)

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: HLEIDSGVITLDPQTASRSLVLSEDRKSVRYTRQKKSLPDSPLRFDGLPA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tripartite motif-containing protein 15

Protein Size: 465

Purification: Affinity Purified
More Information
SKU AVIARP58130_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58130_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Rabbit, Cow (Bovine), Yeast
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 89870
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×