TRIM38 Antibody - middle region : HRP

TRIM38 Antibody - middle region : HRP
SKU
AVIARP57852_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TRIM38 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM38

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: LRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tripartite motif-containing protein 38

Protein Size: 465

Purification: Affinity Purified
More Information
SKU AVIARP57852_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57852_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10475
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×