TRIM49 Antibody - middle region : Biotin

TRIM49 Antibody - middle region : Biotin
SKU
AVIARP58058_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TRIM49 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein has been found to be preferentially expressed in testis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM49

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: NMYRKEKNQNEKIDGKAGLFLLGCVKNDIQCSLFTTSPLMLQYIPKPTSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 452

Purification: Affinity Purified
More Information
SKU AVIARP58058_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58058_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57093
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×