TRMT13 Antibody - N-terminal region : Biotin

TRMT13 Antibody - N-terminal region : Biotin
SKU
AVIARP57328_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRM13

Key Reference: N/A

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: SHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tRNA:m(4)X modification enzyme TRM13 homolog

Protein Size: 481

Purification: Affinity purified
More Information
SKU AVIARP57328_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57328_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54482
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×