TSKS Antibody - middle region : FITC

TSKS Antibody - middle region : FITC
SKU
AVIARP53749_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the TSKS is highest in the testis and down-regulated in testicular cancer. The gene encoded TSKS is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSKS

Key Reference: Hao,Z., (2004) Mol. Hum. Reprod. 10 (6), 433-444

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: ALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-specific serine kinase substrate

Protein Size: 592

Purification: Affinity Purified
More Information
SKU AVIARP53749_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53749_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 60385
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×