TSPAN33 Antibody - middle region : Biotin

TSPAN33 Antibody - middle region : Biotin
SKU
AVIARP55781_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TSPAN33 plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPAN33

Key Reference: Heikens,M.J., (2007) Blood 109 (8), 3244-3252

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tetraspanin-33

Protein Size: 283

Purification: Affinity Purified
More Information
SKU AVIARP55781_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55781_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 340348
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×