TSPAN33 Antibody - middle region : HRP

TSPAN33 Antibody - middle region : HRP
SKU
AVIARP55781_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TSPAN33 plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPAN33

Key Reference: Heikens,M.J., (2007) Blood 109 (8), 3244-3252

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tetraspanin-33

Protein Size: 283

Purification: Affinity Purified
More Information
SKU AVIARP55781_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55781_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 340348
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×