TTC12 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TTC12

Key Reference: Yang,B.Z., (2007) Hum. Mol. Genet. 16 (23), 2844-2853

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tetratricopeptide repeat domain 12, isoform CRA_a EMBL EAW67210.1

Protein Size: 732

Purification: Affinity Purified

• SKU: AVIARP53725_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53725_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54970
• Host: Rabbit
• Conjugate: Conjugated, Biotin