TTC27 Antibody - N-terminal region : HRP

TTC27 Antibody - N-terminal region : HRP
SKU
AVIARP57019_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of TTC27 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TTC27

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: KDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRREGDVLSNCE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tetratricopeptide repeat protein 27

Protein Size: 843

Purification: Affinity Purified
More Information
SKU AVIARP57019_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57019_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55622
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×