TUBA3C Antibody - N-terminal region : HRP

TUBA3C Antibody - N-terminal region : HRP
SKU
AVIARP53649_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUBA3C

Key Reference: Jin,J., (2004) Curr. Biol. 14 (16), 1436-1450

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubulin alpha-3C/D chain

Protein Size: 450

Purification: Affinity Purified
More Information
SKU AVIARP53649_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53649_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7278
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×