TUBB Antibody - N-terminal region : FITC

TUBB Antibody - N-terminal region : FITC
SKU
AVIARP55761_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TUBB belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUBB

Key Reference: Wiesen,K.M., (2007) Cancer Lett. 257 (2), 227-235

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin beta chain

Protein Size: 444

Purification: Affinity Purified
More Information
SKU AVIARP55761_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55761_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 203068
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×