Twf1 Antibody - C-terminal region : HRP

Twf1 Antibody - C-terminal region : HRP
SKU
AVIARP56488_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Twf1 is an actin-binding protein involved in motile and morphological processes. It inhibits actin polymerization, likely by sequestering G-actin. By capping the barbed ends of filaments, it also regulates motility. It seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles.

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: EKLSKRQLNYVQLEIDIKNETIILANTENTELKDLPKRIPKDSARYHFFL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Twinfilin-1

Protein Size: 350

Purification: Affinity Purified
More Information
SKU AVIARP56488_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56488_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 315265
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×