UBE2O Antibody - middle region : HRP

UBE2O Antibody - middle region : HRP
SKU
AVIARP57583_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: UBE2O catalyzes the covalent attachment of ubiquitin to other proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBE2O

Molecular Weight: 141kDa

Peptide Sequence: Synthetic peptide located within the following region: YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin-conjugating enzyme E2 O

Protein Size: 1292

Purification: Affinity Purified
More Information
SKU AVIARP57583_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57583_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 63893
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×