UBQLN4 Antibody - C-terminal region : Biotin

UBQLN4 Antibody - C-terminal region : Biotin
SKU
AVIARP57356_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human UBQLN4

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: QNPESLSILTNPRAMQALLQIQQGLQTLQTEAPGLVPSLGSFGMSRTPAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ubiquilin-4

Protein Size: 423

Purification: Affinity Purified
More Information
SKU AVIARP57356_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57356_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56893
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×