UCHL5IP Antibody - middle region : HRP

UCHL5IP Antibody - middle region : HRP
SKU
AVIARP56968_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UCHL5IP

Key Reference: Hahn,Y. Hum. Genet. 119 (1-2), 169-178 (2006)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 427

Purification: Affinity Purified

Subunit: 7
More Information
SKU AVIARP56968_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56968_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55559
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×