UEVLD Antibody - N-terminal region : Biotin

UEVLD Antibody - N-terminal region : Biotin
SKU
AVIARP57193_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: UEVLD is a possible negative regulator of polyubiquitination.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UEVLD

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin-conjugating enzyme E2 variant 3 Ensembl ENSP00000379499

Protein Size: 379

Purification: Affinity Purified
More Information
SKU AVIARP57193_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57193_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55293
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×