UFSP1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein that is similar to other Ufm1-specific proteases. Studies in mouse determined that Ufsp1 releases Ufm1 (ubiquitin-fold modifier 1) from its bound conjugated complexes which also makes it into an active form. Because the human UFSP1 protein is shorter on the N-terminus and lacks a conserved Cys active site, it is predicted to be non-functional.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human UFSP1

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: DPHYWGTPKSPSELQAAGWVGWQEVSAAFDPNSFYNLCLTSLSSQQQQRT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inactive Ufm1-specific protease 1

Protein Size: 142

Purification: Affinity Purified

• SKU: AVIARP54444_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54444_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 402682
• Host: Rabbit
• Conjugate: Conjugated, Biotin