ULK1 Antibody - N-terminal region : HRP

ULK1 Antibody - N-terminal region : HRP
SKU
AVIARP54261_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ULK1 is a serine/threonine-protein kinase involved in autophagy in response to starvation. It acts upstream of phosphatidylinositol 3-kinase PIK3C3 to regulate the formation of autophagophores, the precursors of autophagosomes. Part of regulatory feedback loops in autophagy: acts both as a downstream effector and negative regulator of mammalian target of rapamycin complex 1 (mTORC1) via interaction with RPTOR. It is activated via phosphorylation by AMPK and also acts as a regulator of AMPK by mediating phosphorylation of AMPK subunits PRKAA1, PRKAB2 and PRKAG1, leading to negatively regulate AMPK activity. It may phosphorylate ATG13/KIAA0652 and RPTOR; however such data need additional evidences and plays a role early in neuronal differentiation and is required for granule cell axon formation.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ULK1

Molecular Weight: 112kDa

Peptide Sequence: Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein kinase ULK1

Protein Size: 1050

Purification: Affinity Purified
More Information
SKU AVIARP54261_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54261_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 8408
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×