UNC45A Antibody - middle region : FITC

UNC45A Antibody - middle region : FITC
SKU
AVIARP56262_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor (PGR; MIM 607311) and HSP90 (HSPCA; MIM 140571), and acts as a regulator of the progesterone receptor chaperoning pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UNC45A

Key Reference: Chadli,A., (2008) J. Biol. Chem. 283 (15), 9509-9512

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein unc-45 homolog A

Protein Size: 929

Purification: Affinity Purified
More Information
SKU AVIARP56262_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56262_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 55898
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×