Urgcp Antibody - N-terminal region : HRP

Urgcp Antibody - N-terminal region : HRP
SKU
AVIARP56287_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Urgcp may be involved in cell cycle progression through the regulation of cyclin D1 expression.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: YGDGTNEAQDNDFPTVERSRLQEMLSLLGLETYQAQKLTLQDSLQISFDS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Up-regulator of cell proliferation

Protein Size: 883

Purification: Affinity Purified
More Information
SKU AVIARP56287_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56287_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 72046
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×