USP12 Antibody - middle region : FITC

USP12 Antibody - middle region : FITC
SKU
AVIARP55812_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: USP12 is a deubiquitinating enzyme. USP12 has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. USP12 is not involved in deubiquitination of monoubiquitinated FANCD2.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human USP12

Key Reference: Dunham,A., (2004) Nature 428 (6982), 522-528

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin carboxyl-terminal hydrolase 12

Protein Size: 370

Purification: Affinity Purified
More Information
SKU AVIARP55812_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55812_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 219333
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×