USP22 Antibody - N-terminal region : FITC

USP22 Antibody - N-terminal region : FITC
SKU
AVIARP58352_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human USP22

Key Reference: Zhang,X.Y., (2008) Mol. Cell 29 (1), 102-111

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin carboxyl-terminal hydrolase 22

Protein Size: 525

Purification: Affinity Purified
More Information
SKU AVIARP58352_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58352_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23326
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×