Usp44 Antibody - N-terminal region : Biotin

Usp44 Antibody - N-terminal region : Biotin
SKU
AVIARP55361_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Usp44

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: PQKWFCMVCNTTESIWACLSCSHVACGQYIQEHALKHFEESSHPVAFEVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Usp44 Ensembl ENSRNOP00000007465

Protein Size: 481

Purification: Affinity Purified
More Information
SKU AVIARP55361_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55361_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 314746
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×