UTY Antibody : FITC

UTY Antibody : FITC
SKU
AVIARP58214_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein containing tetratricopeptide repeats which are thought to be involved in protein-protein interactions. The encoded protein is also a minor histocompatibility antigen which may induce graft rejection of male stem cell grafts. A large number of alternatively spliced transcripts have been observed for this gene, but the full length nature of some of these variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence YKSSLKHFQLALIDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL

Molecular Weight: 150 kDa

Peptide Sequence: Synthetic peptide located within the following region: YKSSLKHFQLALIDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone demethylase UTY

Protein Size: 1347

Purification: Affinity Purified
More Information
SKU AVIARP58214_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58214_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Human Gene ID 7404
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×