UVSSA Antibody - C-terminal region : HRP

UVSSA Antibody - C-terminal region : HRP
SKU
AVIARP57482_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene appears to be involved in ubiquitination and dephosphorylation of RNA polymerase II subunits that stall after UV irradiation. The encoded protein interacts with several members of the nucleotide excision repair complex to help repair UV-induced DNA damage. Defects in this gene can cause UV-sensitive syndrome 3.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human UVSSA

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: GQDLGSSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFAKAAVRRV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: UV-stimulated scaffold protein A

Protein Size: 709

Purification: Affinity Purified
More Information
SKU AVIARP57482_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57482_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57654
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×