VAT1L Antibody - C-terminal region : Biotin

VAT1L Antibody - C-terminal region : Biotin
SKU
AVIARP57490_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human VAT1L

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: VEKVNPIKLYEENKVIAGFSLLNLLFKQGRAGLIRGVVEKLIGLYNQKKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Synaptic vesicle membrane protein VAT-1 homolog-like

Protein Size: 419

Purification: Affinity Purified
More Information
SKU AVIARP57490_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57490_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57687
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×