VIPAS39 Antibody - middle region : Biotin

VIPAS39 Antibody - middle region : Biotin
SKU
AVIARP57585_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat LOC681989

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: PPSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKTYSPELGRPKGEYRDYS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: spermatogenesis-defective protein 39 homolog

Protein Size: 460

Purification: Affinity Purified
More Information
SKU AVIARP57585_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57585_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 681989
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×