Vps36 Antibody - N-terminal region : FITC

Vps36 Antibody - N-terminal region : FITC
SKU
AVIARP56827_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Vps36 is a component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. Its ability to bind ubiquitin probably plays a role in endosomal sorting of ubiquitinated cargo proteins by ESCRT complexes. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. Binds phosphoinosides such as PtdIns(3,4,5)P3.

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SNKEPGPFQSSKNSYIRLSFKEHGQIEFYRRLSEEMTQRRWETVPVSQSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein-sorting-associated protein 36

Protein Size: 386

Purification: Affinity Purified
More Information
SKU AVIARP56827_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56827_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 70160
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×