VPS53 Antibody - middle region : Biotin

VPS53 Antibody - middle region : Biotin
SKU
AVIARP57192_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VPS53

Molecular Weight: 92kDa

Peptide Sequence: Synthetic peptide located within the following region: VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein 53 homolog

Protein Size: 832

Purification: Affinity Purified
More Information
SKU AVIARP57192_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57192_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55275
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×