VPS53 Antibody - middle region : HRP

VPS53 Antibody - middle region : HRP
SKU
AVIARP57192_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VPS53

Molecular Weight: 92kDa

Peptide Sequence: Synthetic peptide located within the following region: VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Vacuolar protein sorting-associated protein 53 homolog

Protein Size: 832

Purification: Affinity Purified
More Information
SKU AVIARP57192_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57192_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55275
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×