VSIG1 Antibody - N-terminal region : HRP

VSIG1 Antibody - N-terminal region : HRP
SKU
AVIARP55832_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VSIG1

Key Reference: Scanlan,M.J., (er) Cancer Immun. 6, 2 (2006)

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: V-set and immunoglobulin domain-containing protein 1

Protein Size: 387

Purification: Affinity Purified
More Information
SKU AVIARP55832_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55832_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 340547
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×