Vwa5a Antibody - C-terminal region : FITC

Vwa5a Antibody - C-terminal region : FITC
SKU
AVIARP55094_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Vwa5a may play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in may contribute directly to or modify tumorigenesis.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: VLSSFTAFIAINKELNKPVQGPLAHRVIPRPVMAGSSSMRFYSSFSGGFK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: von Willebrand factor A domain-containing protein 5A

Protein Size: 793

Purification: Affinity Purified
More Information
SKU AVIARP55094_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55094_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 67776
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×