WBP2 Antibody - N-terminal region : FITC

WBP2 Antibody - N-terminal region : FITC
SKU
AVIARP54911_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WBP2

Key Reference: Dhananjayan,S.C., (2006) Mol. Endocrinol. 20 (10), 2343-2354

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WW domain-binding protein 2

Protein Size: 261

Purification: Affinity Purified
More Information
SKU AVIARP54911_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54911_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23558
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×